PROM1 polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a partial recombinant PROM1.

AB-H00008842-A01

New product

PROM1 polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name PROM1
Gene Alias AC133|CD133|MSTP061|PROML1|RP41
Gene Description prominin 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq STLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PROM1 (NP_006008, 693 a.a. ~ 790 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8842

More info

Mouse polyclonal antibody raised against a partial recombinant PROM1.

Enviar uma mensagem

Mouse polyclonal antibody raised against a partial recombinant PROM1.

Mouse polyclonal antibody raised against a partial recombinant PROM1.