TNFRSF11A polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a partial recombinant TNFRSF11A.

AB-H00008792-A01

New product

TNFRSF11A polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name TNFRSF11A
Gene Alias CD265|FEO|LOH18CR1|ODFR|OFE|OPTB7|OSTS|PDB2|RANK|TRANCER
Gene Description tumor necrosis factor receptor superfamily, member 11a, NFKB activator
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq APPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFRSF11A (NP_003830, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8792

More info

Mouse polyclonal antibody raised against a partial recombinant TNFRSF11A.

Enviar uma mensagem

Mouse polyclonal antibody raised against a partial recombinant TNFRSF11A.

Mouse polyclonal antibody raised against a partial recombinant TNFRSF11A.