SLC4A4 polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a partial recombinant SLC4A4.

AB-H00008671-A01

New product

SLC4A4 polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name SLC4A4
Gene Alias DKFZp781H1314|HNBC1|KNBC|NBC1|NBC2|SLC4A5|hhNMC|pNBC
Gene Description solute carrier family 4, sodium bicarbonate cotransporter, member 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC4A4 (NP_003750, 121 a.a. ~ 229 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8671

More info

Mouse polyclonal antibody raised against a partial recombinant SLC4A4.

Enviar uma mensagem

Mouse polyclonal antibody raised against a partial recombinant SLC4A4.

Mouse polyclonal antibody raised against a partial recombinant SLC4A4.