USP9X monoclonal antibody (M08), clone 2A9 View larger

Mouse monoclonal antibody raised against a partial recombinant USP9X.

AB-H00008239-M08

New product

USP9X monoclonal antibody (M08), clone 2A9

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name USP9X
Gene Alias DFFRX|FAF|FAM
Gene Description ubiquitin specific peptidase 9, X-linked
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP9X (NP_068706, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8239
Clone Number 2A9
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant USP9X.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant USP9X.

Mouse monoclonal antibody raised against a partial recombinant USP9X.