TLR4 monoclonal antibody (M16), clone 3G12 View larger

Mouse monoclonal antibody raised against a full length recombinant TLR4.

AB-H00007099-M16

New product

TLR4 monoclonal antibody (M16), clone 3G12

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name TLR4
Gene Alias ARMD10|CD284|TOLL|hToll
Gene Description toll-like receptor 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR4 (NP_612564.1, 130 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7099
Clone Number 3G12
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a full length recombinant TLR4.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full length recombinant TLR4.

Mouse monoclonal antibody raised against a full length recombinant TLR4.