View larger
Mouse monoclonal antibody raised against a partial recombinant TAF11.
AB-H00006882-M04
New product
TAF11 monoclonal antibody (M04), clone 2G9
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | TAF11 |
| Gene Alias | MGC:15243|PRO2134|TAF2I|TAFII28 |
| Gene Description | TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6882 |
| Clone Number | 2G9 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant TAF11.