View larger
Mouse monoclonal antibody raised against a partial recombinant PRKACA.
AB-H00005566-M01A
New product
PRKACA monoclonal antibody (M01A), clone 1C4
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 200 uL |
| Gene Name | PRKACA |
| Gene Alias | MGC102831|MGC48865|PKACA |
| Gene Description | protein kinase, cAMP-dependent, catalytic, alpha |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 5566 |
| Clone Number | 1C4 |
| Iso type | IgG Mix Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant PRKACA.