View larger
Mouse polyclonal antibody raised against a partial recombinant PHKA2.
AB-H00005256-A01
New product
PHKA2 polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | PHKA2 |
| Gene Alias | GSD9A|MGC133071|PHK|PYK|PYKL|XLG|XLG2 |
| Gene Description | phosphorylase kinase, alpha 2 (liver) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | RRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFT |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PHKA2 (NP_000283, 428 a.a. ~ 521 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 5256 |
More info
Mouse polyclonal antibody raised against a partial recombinant PHKA2.