CHMP1A purified MaxPab mouse polyclonal antibody (B02P) View larger

Mouse polyclonal antibody raised against a full-length human CHMP1A protein.

AB-H00005119-B02P

New product

CHMP1A purified MaxPab mouse polyclonal antibody (B02P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name CHMP1A
Gene Alias CHMP1|KIAA0047|PCOLN3|PRSM1
Gene Description chromatin modifying protein 1A
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHMP1A (N/A, 1 a.a. ~ 196 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5119

More info

Mouse polyclonal antibody raised against a full-length human CHMP1A protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human CHMP1A protein.

Mouse polyclonal antibody raised against a full-length human CHMP1A protein.