View larger
Mouse monoclonal antibody raised against a full-length recombinant NME2.
AB-H00004831-M01A
New product
NME2 monoclonal antibody (M01A), clone S1
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 200 uL |
| Gene Name | NME2 |
| Gene Alias | MGC111212|NDPK-B|NDPKB|NM23-H2|NM23B|puf |
| Gene Description | non-metastatic cells 2, protein (NM23B) expressed in |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NME2 (AAH02476, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 4831 |
| Clone Number | S1 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a full-length recombinant NME2.