NEDD9 monoclonal antibody (M01), clone 1B4 View larger

Mouse monoclonal antibody raised against a partial recombinant NEDD9.

AB-H00004739-M01

New product

NEDD9 monoclonal antibody (M01), clone 1B4

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name NEDD9
Gene Alias CAS-L|CAS2|CASL|CASS2|HEF1|dJ49G10.2|dJ761I2.1
Gene Description neural precursor cell expressed, developmentally down-regulated 9
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEDD9 (NP_006394, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4739
Clone Number 1B4
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant NEDD9.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant NEDD9.

Mouse monoclonal antibody raised against a partial recombinant NEDD9.