AB-H00004739-M01
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 50 ug |
Gene Name | NEDD9 |
Gene Alias | CAS-L|CAS2|CASL|CASS2|HEF1|dJ49G10.2|dJ761I2.1 |
Gene Description | neural precursor cell expressed, developmentally down-regulated 9 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Tr,WB-Re,ELISA,IF |
Immunogen Prot. Seq | PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | NEDD9 (NP_006394, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 4739 |
Clone Number | 1B4 |
Iso type | IgG1 Kappa |