SMAD2 monoclonal antibody (M01), clone 4D10 View larger

Mouse monoclonal antibody raised against a partial recombinant SMAD2.

AB-H00004087-M01

New product

SMAD2 monoclonal antibody (M01), clone 4D10

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name SMAD2
Gene Alias JV18|JV18-1|MADH2|MADR2|MGC22139|MGC34440|hMAD-2|hSMAD2
Gene Description SMAD family member 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD2 (AAH25699, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4087
Clone Number 4D10
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant SMAD2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant SMAD2.

Mouse monoclonal antibody raised against a partial recombinant SMAD2.