LHX1 polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a partial recombinant LHX1.

AB-H00003975-A01

New product

LHX1 polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name LHX1
Gene Alias LIM-1|LIM1|MGC126723|MGC138141
Gene Description LIM homeobox 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX1 (NP_005559, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3975

More info

Mouse polyclonal antibody raised against a partial recombinant LHX1.

Enviar uma mensagem

Mouse polyclonal antibody raised against a partial recombinant LHX1.

Mouse polyclonal antibody raised against a partial recombinant LHX1.