View larger
Mouse monoclonal antibody raised against a partial recombinant LAMB3.
AB-H00003914-M01
New product
LAMB3 monoclonal antibody (M01), clone 2G10
Não há pontos de recompensa para este produto.
Data sheet
| Size | 100 ug |
| Gene Name | LAMB3 |
| Gene Alias | BM600-125KDA|FLJ99565|LAM5|LAMNB1 |
| Gene Description | laminin, beta 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | LAMB3 (NP_000219, 1064 a.a. ~ 1171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3914 |
| Clone Number | 2G10 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant LAMB3.