AB-H00003914-M01
New product
This product is no longer in stock
Availability date:
Não há pontos de recompensa para este produto.
Size | 100 ug |
Gene Name | LAMB3 |
Gene Alias | BM600-125KDA|FLJ99565|LAM5|LAMNB1 |
Gene Description | laminin, beta 3 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,WB-Re,S-ELISA,ELISA,IF |
Immunogen Prot. Seq | AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | LAMB3 (NP_000219, 1064 a.a. ~ 1171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 3914 |
Clone Number | 2G10 |
Iso type | IgG1 Kappa |