View larger
Mouse monoclonal antibody raised against a full length recombinant IL15.
AB-H00003600-M14
New product
IL15 monoclonal antibody (M14), clone 3A4
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | IL15 |
| Gene Alias | IL-15|MGC9721 |
| Gene Description | interleukin 15 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA,IF |
| Immunogen Prot. Seq | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3600 |
| Clone Number | 3A4 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant IL15.