RBPJ monoclonal antibody (M01), clone 4E12 View larger

Mouse monoclonal antibody raised against a partial recombinant RBPJ.

AB-H00003516-M01

New product

RBPJ monoclonal antibody (M01), clone 4E12

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name RBPJ
Gene Alias CBF1|IGKJRB|IGKJRB1|KBF2|MGC61669|RBP-J|RBPJK|RBPSUH|SUH|csl
Gene Description recombination signal binding protein for immunoglobulin kappa J region
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq WIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBPJ (NP_976029, 3 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3516
Clone Number 4E12
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant RBPJ.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant RBPJ.

Mouse monoclonal antibody raised against a partial recombinant RBPJ.