AB-H00003172-M05
New product
This product is no longer in stock
Availability date:
Não há pontos de recompensa para este produto.
Size | 100 ug |
Gene Name | HNF4A |
Gene Alias | FLJ39654|HNF4|HNF4a7|HNF4a8|HNF4a9|MODY|MODY1|NR2A1|NR2A21|TCF|TCF14 |
Gene Description | hepatocyte nuclear factor 4, alpha |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,WB-Re,ELISA,IF |
Immunogen Prot. Seq | NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | HNF4A (NP_000448, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 3172 |
Clone Number | 1F12 |
Iso type | IgG2a Kappa |