HNF4A monoclonal antibody (M05), clone 1F12 View larger

Mouse monoclonal antibody raised against a partial recombinant HNF4A.

AB-H00003172-M05

New product

HNF4A monoclonal antibody (M05), clone 1F12

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 100 ug
Gene Name HNF4A
Gene Alias FLJ39654|HNF4|HNF4a7|HNF4a8|HNF4a9|MODY|MODY1|NR2A1|NR2A21|TCF|TCF14
Gene Description hepatocyte nuclear factor 4, alpha
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HNF4A (NP_000448, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3172
Clone Number 1F12
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant HNF4A.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant HNF4A.

Mouse monoclonal antibody raised against a partial recombinant HNF4A.