AB-H00002517-A01
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 50 uL |
Gene Name | FUCA1 |
Gene Alias | FUCA |
Gene Description | fucosidase, alpha-L- 1, tissue |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Re,ELISA |
Immunogen Prot. Seq | EAIYASKPWRVQWEKNITSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | FUCA1 (NP_000138, 362 a.a. ~ 461 a.a) partial recombinant protein with GST tag. |
Storage Buffer | 50 % glycerol |
Gene ID | 2517 |