FOSL2 monoclonal antibody (M01), clone 2B4-1C2 View larger

Mouse monoclonal antibody raised against a full length recombinant FOSL2.

AB-H00002355-M01

New product

FOSL2 monoclonal antibody (M01), clone 2B4-1C2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name FOSL2
Gene Alias FLJ23306|FRA2
Gene Description FOS-like antigen 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FOSL2 (AAH08899, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2355
Clone Number 2B4-1C2
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a full length recombinant FOSL2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full length recombinant FOSL2.

Mouse monoclonal antibody raised against a full length recombinant FOSL2.