View larger
Mouse monoclonal antibody raised against a full length recombinant CD7.
AB-H00000924-M04
New product
CD7 monoclonal antibody (M04), clone 1B8
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | CD7 |
| Gene Alias | GP40|LEU-9|TP41|Tp40 |
| Gene Description | CD7 molecule |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,IP,S-ELISA,ELISA |
| Immunogen Prot. Seq | PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CD7 (AAH09293, 21 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 924 |
| Clone Number | 1B8 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant CD7.