BMP5 monoclonal antibody (M07), clone 4B3 View larger

Mouse monoclonal antibody raised against a partial recombinant BMP5.

AB-H00000653-M07

New product

BMP5 monoclonal antibody (M07), clone 4B3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name BMP5
Gene Alias MGC34244
Gene Description bone morphogenetic protein 5
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BMP5 (NP_066551.1, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 653
Clone Number 4B3
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant BMP5.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant BMP5.

Mouse monoclonal antibody raised against a partial recombinant BMP5.