ATP7B monoclonal antibody (M03), clone 3A11 View larger

Mouse monoclonal antibody raised against a partial recombinant ATP7B.

AB-H00000540-M03

New product

ATP7B monoclonal antibody (M03), clone 3A11

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ATP7B
Gene Alias PWD|WC1|WD|WND
Gene Description ATPase, Cu++ transporting, beta polypeptide
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP7B (NP_000044, 1372 a.a. ~ 1465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 540
Clone Number 3A11
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant ATP7B.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant ATP7B.

Mouse monoclonal antibody raised against a partial recombinant ATP7B.