> >>>Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
Nuevo Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. Ver mas grande

Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00083953-Q01

Producto nuevo

FCAMR (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name FCAMR
Gene Alias FCA/MR|FKSG87
Gene Description Fc receptor, IgA, IgM, high affinity
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq TLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRLSQLSPDDIGC
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 83953

Más información

Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Human FCAMR partial ORF ( NP_114418.1, 63 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.