Ver mas grande
Rabit IGF1 (Q95222, 4 a.a. - 70 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P8187
Producto nuevo
IGF1 (Rabit) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | IGF-IB |
| Gene Alias | - |
| Gene Description | insulin-like growth factor IB |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MTAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKP |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile 0.4% NaHCO3, pH 8-9 > |
| Gene ID | 100008668 |
Más información
Rabit IGF1 (Q95222, 4 a.a. - 70 a.a.) partial recombinant protein expressed in Escherichia coli.