Ver mas grande
Human CHAC2 full-length ORF ( NP_001008708.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00494143-P01
Producto nuevo
CHAC2 (Human) Recombinant Protein (P01)
No hay Biopuntos para este producto
Hoja técnica
| Size | 10 ug |
| Gene Name | CHAC2 |
| Gene Alias | - |
| Gene Description | ChaC, cation transport regulator homolog 2 (E. coli) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 494143 |
Más información
Human CHAC2 full-length ORF ( NP_001008708.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.