> >>>Human RKHD1 partial ORF ( NP_976049, 418 a.a. - 488 a.a.) recombinant protein with GST-tag at N-terminal.
RKHD1 (Human) Recombinant Protein (Q01) Ver mas grande

Human RKHD1 partial ORF ( NP_976049, 418 a.a. - 488 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00399664-Q01

Producto nuevo

RKHD1 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name MEX3D
Gene Alias KIAA2031|MEX-3D|MEX3|OK/SW-cl.4|RKHD1|RNF193|TINO
Gene Description mex-3 homolog D (C. elegans)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq LARECVVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIRVETETPQPGGASALQRQY
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 399664

Más información

Human RKHD1 partial ORF ( NP_976049, 418 a.a. - 488 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human RKHD1 partial ORF ( NP_976049, 418 a.a. - 488 a.a.) recombinant protein with GST-tag at N-terminal.

Human RKHD1 partial ORF ( NP_976049, 418 a.a. - 488 a.a.) recombinant protein with GST-tag at N-terminal.