> >>>Human DNAJC18 full-length ORF ( NP_689899.1, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.
DNAJC18 (Human) Recombinant Protein (P01) Ver mas grande

Human DNAJC18 full-length ORF ( NP_689899.1, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00202052-P01

Producto nuevo

DNAJC18 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name DNAJC18
Gene Alias MGC29463
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 18
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MAATLGSGERWTEAYIDAVRRNKYPEDTPPESHDPCGCCNCMKAQKEKKSENEWTQTRQGEGNSTYSEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDEYGDEQVTFTAPRARPYNYYRDFEADITPEELFNVFFGGHFPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLLATNPPYS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 202052

Más información

Human DNAJC18 full-length ORF ( NP_689899.1, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human DNAJC18 full-length ORF ( NP_689899.1, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

Human DNAJC18 full-length ORF ( NP_689899.1, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.