BBS12 (Human) Recombinant Protein (P01) Ver mas grande

Human BBS12 full-length ORF ( NP_689831.2, 1 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00166379-P01

Producto nuevo

BBS12 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name BBS12
Gene Alias C4orf24|FLJ35630|FLJ41559
Gene Description Bardet-Biedl syndrome 12
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MVMACRVVNKRRHMGLQQLSSFAETGRTFLGPLKSSKFIIDEECHESVLISSTVRLLESLDLTSAVGQLLNEAVQAQNNTYRTGISTLLFLVGAWSSAVEECLHLGVPISIIVSVMSEGLNFCSEEVVSLHVPVHNIFDCMDSTKTFSQLETFSVSLCPFLQVPSDTDLIEELHGLKDVASQTLTISNLSGRPLKSYELFKPQTKVEADNNTSRTLKNSLLADTCCRQSILIHSRHFNRTDNTEGVSKPDGFQEH
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 166379

Más información

Human BBS12 full-length ORF ( NP_689831.2, 1 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human BBS12 full-length ORF ( NP_689831.2, 1 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.

Human BBS12 full-length ORF ( NP_689831.2, 1 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.