Ver mas grande
Human TBN full-length ORF ( AAH33728.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00129685-P01
Producto nuevo
TBN (Human) Recombinant Protein (P01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | TAF8 |
| Gene Alias | 43|FLJ32821|II|TAF|TAFII43|TBN |
| Gene Description | TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 129685 |
Más información
Human TBN full-length ORF ( AAH33728.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.