EFHC1 (Human) Recombinant Protein (P01) Ver mas grande

Human EFHC1 full-length ORF ( AAH20210.1, 1 a.a. - 640 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00114327-P01

Producto nuevo

EFHC1 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

No hay Biopuntos para este producto


Hoja técnica

Size 10 ug
Gene Name EFHC1
Gene Alias EJM|EJM1|FLJ10466|FLJ37290|JAE|dJ304B14.2
Gene Description EF-hand domain (C-terminal) containing 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRKQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSM
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 114327

Más información

Human EFHC1 full-length ORF ( AAH20210.1, 1 a.a. - 640 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human EFHC1 full-length ORF ( AAH20210.1, 1 a.a. - 640 a.a.) recombinant protein with GST-tag at N-terminal.

Human EFHC1 full-length ORF ( AAH20210.1, 1 a.a. - 640 a.a.) recombinant protein with GST-tag at N-terminal.