> >>>Human TGIF2LX full-length ORF ( NP_620410.3, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
TGIF2LX (Human) Recombinant Protein (P01) Ver mas grande

Human TGIF2LX full-length ORF ( NP_620410.3, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00090316-P01

Producto nuevo

TGIF2LX (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name TGIF2LX
Gene Alias MGC34726|TGIFLX
Gene Description TGFB-induced factor homeobox 2-like, X-linked
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 90316

Más información

Human TGIF2LX full-length ORF ( NP_620410.3, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human TGIF2LX full-length ORF ( NP_620410.3, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Human TGIF2LX full-length ORF ( NP_620410.3, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.