PCGF6 (Human) Recombinant Protein (P01) Ver mas grande

Human PCGF6 full-length ORF ( AAH07602.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00084108-P01

Producto nuevo

PCGF6 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name PCGF6
Gene Alias MBLR|MGC15678|MGC17541|RNF134
Gene Description polycomb group ring finger 6
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MEGVAVVTAGSVGAAKTEGAAALPPPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSRPPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEERLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIRRAIGD
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 84108

Más información

Human PCGF6 full-length ORF ( AAH07602.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human PCGF6 full-length ORF ( AAH07602.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.

Human PCGF6 full-length ORF ( AAH07602.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.