Nuevo DKFZP566M114 (Human) Recombinant Protein (P01) Ver mas grande

Human DKFZP566M114 full-length ORF ( AAH63471, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00084068-P01

Producto nuevo

DKFZP566M114 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name SLC10A7
Gene Alias C4orf13|DKFZp313H0531|DKFZp566M114|DKFZp779O2438|MGC25043|P7
Gene Description solute carrier family 10 (sodium/bile acid cotransporter family), member 7
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQLLL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 84068

Más información

Human DKFZP566M114 full-length ORF ( AAH63471, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human DKFZP566M114 full-length ORF ( AAH63471, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.

Human DKFZP566M114 full-length ORF ( AAH63471, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.