> >>>Human TLR10 full-length ORF (NP_001017388.1, 1 a.a. - 811 a.a.) recombinant protein with GST tag at N-terminal.
TLR10 (Human) Recombinant Protein (P02) Ver mas grande

Human TLR10 full-length ORF (NP_001017388.1, 1 a.a. - 811 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00081793-P02

Producto nuevo

TLR10 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name TLR10
Gene Alias CD290|MGC104967|MGC126398|MGC126399
Gene Description toll-like receptor 10
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 81793

Más información

Human TLR10 full-length ORF (NP_001017388.1, 1 a.a. - 811 a.a.) recombinant protein with GST tag at N-terminal.

Consulta sobre un producto

Human TLR10 full-length ORF (NP_001017388.1, 1 a.a. - 811 a.a.) recombinant protein with GST tag at N-terminal.

Human TLR10 full-length ORF (NP_001017388.1, 1 a.a. - 811 a.a.) recombinant protein with GST tag at N-terminal.