MED28 (Human) Recombinant Protein (P01) Ver mas grande

Human MED28 full-length ORF (NP_079481.2, 1 a.a. - 178 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00080306-P01

Producto nuevo

MED28 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name MED28
Gene Alias 1500003D12Rik|DKFZp434N185|EG1|magicin
Gene Description mediator complex subunit 28
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 80306

Más información

Human MED28 full-length ORF (NP_079481.2, 1 a.a. - 178 a.a.) recombinant protein with GST tag at N-terminal.

Consulta sobre un producto

Human MED28 full-length ORF (NP_079481.2, 1 a.a. - 178 a.a.) recombinant protein with GST tag at N-terminal.

Human MED28 full-length ORF (NP_079481.2, 1 a.a. - 178 a.a.) recombinant protein with GST tag at N-terminal.