MOGAT2 (Human) Recombinant Protein (P01) Ver mas grande

MOGAT2 (Human) Recombinant Protein (P01)

AB-H00080168-P01

Producto nuevo

MOGAT2 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 2 ug
Gene Name MOGAT2
Gene Alias DGAT2L5|FLJ22644|MGAT2|MGC119183|MGC119184|MGC119185
Gene Description monoacylglycerol O-acyltransferase 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGYQASGKSTLGSVGNWQGFYFGGKMAETNADSILVEIFS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 80168

Más información

Human MOGAT2 full-length ORF ( AAI03879.1, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

MOGAT2 (Human) Recombinant Protein (P01)

MOGAT2 (Human) Recombinant Protein (P01)