FLJ23311 (Human) Recombinant Protein (P01) Ver mas grande

Human FLJ23311 full-length ORF ( AAH28244, 1 a.a. - 431 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00079733-P01

Producto nuevo

FLJ23311 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name E2F8
Gene Alias FLJ23311
Gene Description E2F transcription factor 8
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MAQLAAICKMQLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGLSPTVCTTHSSKATGSKDSTDATTEKAANDTSKASASTRPGSLLPAPERQGAKSRTREPAGERGSKRASMLEDSGSKKKFKEDLKGLENVSATLFPSGYLIPLTQCSSLGAESILSGKENSSALSPNHRIYSSPIAGVIPVTSSELTAVNFP
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 79733

Más información

Human FLJ23311 full-length ORF ( AAH28244, 1 a.a. - 431 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human FLJ23311 full-length ORF ( AAH28244, 1 a.a. - 431 a.a.) recombinant protein with GST-tag at N-terminal.

Human FLJ23311 full-length ORF ( AAH28244, 1 a.a. - 431 a.a.) recombinant protein with GST-tag at N-terminal.