Ver mas grande
Human NUCKS1 full-length ORF ( NP_073568.2, 1 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00064710-P01
Producto nuevo
NUCKS1 (Human) Recombinant Protein (P01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | NUCKS1 |
| Gene Alias | FLJ21480|FLJ32016|FLJ38536|JC7|NUCKS |
| Gene Description | nuclear casein kinase and cyclin-dependent kinase substrate 1 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 64710 |
Más información
Human NUCKS1 full-length ORF ( NP_073568.2, 1 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.