> >>>Human NECAB3 full-length ORF ( AAH47673.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal.
Nuevo NECAB3 (Human) Recombinant Protein (P01) Ver mas grande

Human NECAB3 full-length ORF ( AAH47673.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00063941-P01

Producto nuevo

NECAB3 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name NECAB3
Gene Alias APBA2BP|EFCBP3|NIP1|STIP3|SYTIP2|XB51|dJ63M2.4|dJ63M2.5
Gene Description N-terminal EF-hand calcium binding protein 3
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 63941

Más información

Human NECAB3 full-length ORF ( AAH47673.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human NECAB3 full-length ORF ( AAH47673.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal.

Human NECAB3 full-length ORF ( AAH47673.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal.