IL22RA1 (Human) Recombinant Protein (Q01) Ver mas grande

Human IL22RA1 partial ORF ( NP_067081, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00058985-Q01

Producto nuevo

IL22RA1 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name IL22RA1
Gene Alias CRF2-9|IL22R|IL22R1
Gene Description interleukin 22 receptor, alpha 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMT
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 58985

Más información

Human IL22RA1 partial ORF ( NP_067081, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human IL22RA1 partial ORF ( NP_067081, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Human IL22RA1 partial ORF ( NP_067081, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.