> >>>Human C19orf80 full-length ORF ( AAI46553.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.
C19orf80 (Human) Recombinant Protein (P01) Ver mas grande

Human C19orf80 full-length ORF ( AAI46553.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00055908-P01

Producto nuevo

C19orf80 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name C19orf80
Gene Alias RIFL|TD26|PRO1185|PVPA599
Gene Description chromosome 19 open reading frame 80
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGDALPPFPGAQPLTGRAWLGSSPVMYCTRTARLRTEPWRLLKLRLLYLRPSVMPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 55908

Más información

Human C19orf80 full-length ORF ( AAI46553.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human C19orf80 full-length ORF ( AAI46553.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.

Human C19orf80 full-length ORF ( AAI46553.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.