> >>>Human DNAJB11 full-length ORF ( AAH01144, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.
DNAJB11 (Human) Recombinant Protein (P01) Ver mas grande

Human DNAJB11 full-length ORF ( AAH01144, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00051726-P01

Producto nuevo

DNAJB11 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name DNAJB11
Gene Alias ABBP-2|ABBP2|DJ9|EDJ|ERdj3|ERj3|HEDJ|PRO1080|UNQ537|hDj9
Gene Description DnaJ (Hsp40) homolog, subfamily B, member 11
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERRG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 51726

Más información

Human DNAJB11 full-length ORF ( AAH01144, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human DNAJB11 full-length ORF ( AAH01144, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

Human DNAJB11 full-length ORF ( AAH01144, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.