Ver mas grande
Human NUDT13 full-length ORF ( AAH46173.2, 1 a.a. - 263 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00025961-P01
Producto nuevo
NUDT13 (Human) Recombinant Protein (P01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | NUDT13 |
| Gene Alias | - |
| Gene Description | nudix (nucleoside diphosphate linked moiety X)-type motif 13 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQTSAHQYLAPRHSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISASLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWHDAHQFCSRSGQPTKKNVAGSKRVCPSNNIIYYPQIQVNLRELETAAWFSHDEVATALKRKGPYTQQQNGTFPFWLPPKLAISHQLIKEWVEK |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 25961 |
Más información
Human NUDT13 full-length ORF ( AAH46173.2, 1 a.a. - 263 a.a.) recombinant protein with GST-tag at N-terminal.