> >>>Human NGEF partial ORF ( NP_062824.1, 612 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.
NGEF (Human) Recombinant Protein (Q01) Ver mas grande

Human NGEF partial ORF ( NP_062824.1, 612 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00025791-Q01

Producto nuevo

NGEF (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name NGEF
Gene Alias EPHEXIN
Gene Description neuronal guanine nucleotide exchange factor
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq LDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 25791

Más información

Human NGEF partial ORF ( NP_062824.1, 612 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human NGEF partial ORF ( NP_062824.1, 612 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.

Human NGEF partial ORF ( NP_062824.1, 612 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.