> >>>Human DICER1 partial ORF ( NP_803187, 1813 a.a. - 1912 a.a.) recombinant protein with GST-tag at N-terminal.
DICER1 (Human) Recombinant Protein (Q01) Ver mas grande

Human DICER1 partial ORF ( NP_803187, 1813 a.a. - 1912 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00023405-Q01

Producto nuevo

DICER1 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name DICER1
Gene Alias DCR1|Dicer|HERNA|KIAA0928
Gene Description dicer 1, ribonuclease type III
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 23405

Más información

Human DICER1 partial ORF ( NP_803187, 1813 a.a. - 1912 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human DICER1 partial ORF ( NP_803187, 1813 a.a. - 1912 a.a.) recombinant protein with GST-tag at N-terminal.

Human DICER1 partial ORF ( NP_803187, 1813 a.a. - 1912 a.a.) recombinant protein with GST-tag at N-terminal.