> >>>Human AKR7A3 full-length ORF ( AAH25709, 1 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.
Nuevo AKR7A3 (Human) Recombinant Protein (P01) Ver mas grande

Human AKR7A3 full-length ORF ( AAH25709, 1 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00022977-P01

Producto nuevo

AKR7A3 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name AKR7A3
Gene Alias AFAR2
Gene Description aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 22977

Más información

Human AKR7A3 full-length ORF ( AAH25709, 1 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human AKR7A3 full-length ORF ( AAH25709, 1 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.

Human AKR7A3 full-length ORF ( AAH25709, 1 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.