> >>>Human TSPAN2 partial ORF ( NP_005716, 112 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
TSPAN2 (Human) Recombinant Protein (Q01) Ver mas grande

Human TSPAN2 partial ORF ( NP_005716, 112 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00010100-Q01

Producto nuevo

TSPAN2 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name TSPAN2
Gene Alias 6330415F13Rik|FLJ12082|TSN2|TSPAN-2
Gene Description tetraspanin 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 10100

Más información

Human TSPAN2 partial ORF ( NP_005716, 112 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human TSPAN2 partial ORF ( NP_005716, 112 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Human TSPAN2 partial ORF ( NP_005716, 112 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.