MFN2 (Human) Recombinant Protein (P01) Ver mas grande

Human MFN2 full-length ORF (NP_055689.1, 1 a.a. - 757 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00009927-P01

Producto nuevo

MFN2 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 2 ug
Gene Name MFN2
Gene Alias CMT2A|CMT2A2|CPRP1|HSG|KIAA0214|MARF
Gene Description mitofusin 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFI
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 9927

Más información

Human MFN2 full-length ORF (NP_055689.1, 1 a.a. - 757 a.a.) recombinant protein with GST tag at N-terminal.

Consulta sobre un producto

Human MFN2 full-length ORF (NP_055689.1, 1 a.a. - 757 a.a.) recombinant protein with GST tag at N-terminal.

Human MFN2 full-length ORF (NP_055689.1, 1 a.a. - 757 a.a.) recombinant protein with GST tag at N-terminal.