> >>>Human MORF4L2 full-length ORF ( NP_036418.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.
MORF4L2 (Human) Recombinant Protein (P01) Ver mas grande

Human MORF4L2 full-length ORF ( NP_036418.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00009643-P01

Producto nuevo

MORF4L2 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name MORF4L2
Gene Alias KIAA0026|MORFL2|MRGX
Gene Description mortality factor 4 like 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGY
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 9643

Más información

Human MORF4L2 full-length ORF ( NP_036418.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human MORF4L2 full-length ORF ( NP_036418.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

Human MORF4L2 full-length ORF ( NP_036418.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.