Ver mas grande
Human RAB28 full-length ORF ( AAH18067, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00009364-P01
Producto nuevo
RAB28 (Human) Recombinant Protein (P01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | RAB28 |
| Gene Alias | MGC41862 |
| Gene Description | RAB28, member RAS oncogene family |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQLIWSICEQ |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 9364 |
Más información
Human RAB28 full-length ORF ( AAH18067, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.